PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR05G01720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB_related
Protein Properties Length: 1874aa    MW: 202652 Da    PI: 7.5971
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR05G01720.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding254.3e-08950993247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT eE e + +  + +G++ +++I++ +  ++t  +c+++++k+
  LPERR05G01720.1 950 NPWTREEKEVFMEKLATFGKD-FSKISSFLK-HKTTADCIEFYYKH 993
                      58*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-14936997IPR009057Homeodomain-like
PROSITE profilePS5129316.266947998IPR017884SANT domain
SMARTSM007172.2E-8948996IPR001005SANT/Myb domain
PfamPF002493.6E-6950993IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-6951995IPR009057Homeodomain-like
PROSITE profilePS5129313.26911541205IPR017884SANT domain
SMARTSM007177.9E-511551203IPR001005SANT/Myb domain
SuperFamilySSF466898.58E-911581205IPR009057Homeodomain-like
CDDcd001673.62E-411591197No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1874 aa     Download sequence    Send to blast
MASTPAAGSA GDERRRWRRG RGGFGFGAGG RRPPRGREDA NQLGLTAWVG LRLLSIPPSV  60
FLPSEPKAIL SPLSLSLSSP LLLPPPPPPS SQISAGLLLR LRLPDVVFSA PPGVAACTVA  120
TSACIDDDHH SHLPPPLKEG REVGFSCLCD CGGATAADQD RCRLCRRRVG SDRRKRSWLR  180
RAYVICGGGR SCGRRRPRRR GCLPRRRIGG TSCTGTAAGM TAAAASPSHR QPPRRRVGAT  240
RRTTRLRRRL PSATTPGPHL AARRRRPPQG GGSYDRSYPD ESLGYTPSRS ERYWLEEDGY  300
KGFSRYGGGG GGGGGSRRDG RDMRGSYRRS PFRGYGSDFS RNHQEHLPPP LRRSPLRSIA  360
VSTSYDPSGD RADRGDRDHH HRVTPWRPVR RRESRSDAGD AAGAGAVPVG QAAAAPVSEK  420
DVSAQSLAVA APQVSEEEAP RKKPRLGWGQ GLAKYEKQKV QGPADSAEAV VEGSPTATEQ  480
KTATQTPASE PCTSPVVAAP SLSVAAPSPA PPCKSPVPEE KSCEVTNTVA ESNKNIPEAD  540
VQACNNEIPI TLDQLEGDPI DSLAKVLSEL VQHEDSCSGD SKRLTNSSKL LLLKESISKE  600
LEKTELEIDS LEGELKSVNA EARKRTLRDP PATVTYAQDP SPSPVKEQGE LTPSPNISME  660
QDADVKVVDP MEVETAQAHN PKAVSSEESV ACPEIAQGQV SAAADVVPCD ASRKIGPAID  720
VDNEQHEVDP CHDNLNAMKE DGSIGLTTKP CSSHDANLFH QITAVNMNEA KDASELLFKH  780
VPADQSHLDL LTLNHLSSRE KDDLIIKRKH AILKNRQRFK EQILTFKFRV LRHLWKEDVR  840
LLSVRKQRSK SHKRTDQSNR AAQSGSQRQR SSNRSRLSVP AGNINTFPIT EMSGVANKLF  900
SEFQLKRCRN YLKMPTQIID EKEKVGARFV SKNGLVEDPI LVEKERALVN PWTREEKEVF  960
MEKLATFGKD FSKISSFLKH KTTADCIEFY YKHHKSESFR EVKKLLDLRQ QQQPASNYLG  1020
AISGKKWNPE ANAASLDMLG VATEVAAQGL EYANEVKKNS AKSIMRNACG ADNSSKGSED  1080
CVGDVSLHER ESVAADVLAG ICGTLSPEGM GSCITSSADP GQKMGISRME HLLTPEADKN  1140
FDDDGTVSDQ ECEVDIVDWN DDEKSIFIEA ISNYGKDFAQ ISSCVKSKSF EQCKVFFSKA  1200
RKSLGLDMIR QSAADAGFPT GDGNGGRSGT DGACVAEMDS AICSAQSCPE MEIDACPVSD  1260
GDIQGHHPLS DIVSEPAEAD KSNVPDIDVN VEESAVPDID VNVEEGGSKA EKNHNIIVDH  1320
KQLCEDTRQT SCAHIDINCP ESTDTLQDIE DVAPVNMHGN DATVEQAVAA HVDIRSSLHP  1380
VEVVESSRVS EGNSMDLSSK GRSHGSEFGK GGKSTLSVCL PANGVSKENI IHFSNMAGAS  1440
SVGPAFTSNY QQSKLADPIQ SKPKPLTPKD LLPVQFSSPL PDPTSICFEG IAAITTPSFK  1500
DHGSIVSIAS GAKDVNMFPT FKDQSGNRHD ALFHNVDGYM QHKRNNHLKT EVSILPETTI  1560
SCNAGISQSD QFAVPKFQNG RSSSLGLSDA NLGVLSTGNR EEVREGLFRP SSVKASAGNE  1620
EQQKRPGDVK LFGQILSHQS SVQSSGSSVY GSKNKPPSPK VEKSASRLLS NSREPLIYSS  1680
RPPMIANLGL EERAMRGYDH LDGRAMHSEL PSPKVEKSAS TRLLSNSRER LIYSSGPPII  1740
ADLGLDASAT RSYAHLDGRS MQPEPMVMVA KCQRSSAGVP VYSTKNGALS VFAEFQQPSM  1800
QSHPPDHKLM EIADLHKRNG MDLISGFQQP GRLGGPGVLV SGVSDPVAAL KAQYGPGSKM  1860
LSNDVDTWKD IGSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-159091000494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-159091000494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193206RRRPRRRGCLPRRR
2194199RRPRRR
3246265RRRLPSATTPGPHLAARRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0706530.0AK070653.1 Oryza sativa Japonica Group cDNA clone:J023055D14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015639126.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639127.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639128.10.0PREDICTED: uncharacterized protein LOC9268524
RefseqXP_015639129.10.0PREDICTED: uncharacterized protein LOC9268524
TrEMBLA0A0D9WCA20.0A0A0D9WCA2_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g03550.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.15e-80MYB family protein